PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1961s0078.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ARF
Protein Properties Length: 1018aa    MW: 112919 Da    PI: 6.4772
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1961s0078.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.33e-2370171199
                          EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                          f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++  +W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F 
  Cagra.1961s0078.1.p  70 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFV 157
                          99*****************************954.4444.48************************************************ PP

                          E-SSSEE..EEEEE-S CS
                   B3  84 ldgrsefelvvkvfrk 99 
                            ++++ +l+++++r+
  Cagra.1961s0078.1.p 158 --RDEKSQLMLGIRRA 171
                          ..4567778****997 PP

2Auxin_resp118.64.9e-39196278183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          aaha +++s+F++++nPras+seFvv+++k++kal+ +vs+GmRf+m+feted+  rr++Gtv+g+sdldpvrW++S+Wr+L+
  Cagra.1961s0078.1.p 196 AAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQ 278
                          799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.14E-4460199IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.4E-4264185IPR015300DNA-binding pseudobarrel domain
CDDcd100176.11E-2169170No hitNo description
PROSITE profilePS5086312.53470172IPR003340B3 DNA binding domain
PfamPF023621.4E-2170171IPR003340B3 DNA binding domain
SMARTSM010191.0E-2470172IPR003340B3 DNA binding domain
PfamPF065076.9E-34196278IPR010525Auxin response factor
PfamPF023091.2E-9887975IPR033389AUX/IAA domain
PROSITE profilePS5174524.801889982IPR000270PB1 domain
SuperFamilySSF542771.5E-8903967No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1018 aa     Download sequence    Send to blast
MQKQTDFIPN YPNLPSKLIC LLHSVTLHAD TETDEVYAQM TLQPVNKYDR EALLASDMGL  60
KLNRQPTEFF CKTLTASDTS THGGFSVPRR AAEKIFPPLD FSMQPPAQEI VAKDLHDTTW  120
TFRHIYRGQP KRHLLTTGWS VFVSTKRLFA GDSVLFVRDE KSQLMLGIRR ANRQTPTLSS  180
SVISSDSMHI GILAAAAHAN ANSSPFTIFF NPRASPSEFV VPLAKYNKAL YAQVSLGMRF  240
RMMFETEDCG VRRYMGTVTG ISDLDPVRWK GSQWRNLQVG WDESTAGDRP SRVSIWEIEP  300
VITPFYICPP PFFRPKYPRQ PGMPDDELDM ENAFKRAMPW MGEEFGMKDA QSSMFPGLSL  360
VQWMSMQQNN PLSGSATPQL PSALSSYNLP NNFASNDPSK LLNFQSPNLS SANSQFNKLN  420
TVNHISQQMQ AQPAMVKSQQ QQQQQQLQMS HQQLQQQGIY NTGSINNDVS AVANQVSCQN  480
PHQSTTQSQL QQQSMLPNGV KMTHQNIHSG NKGSSQMTSF AQELQFQQQL ELHNSSQSLR  540
NQQEQSSLHS LQQSLSQNPQ QLQMQQQSPK PSPSQQLQLQ LLQKLQQQQQ QQSIPPVTSS  600
LQPQFSALQQ PQSHQLQQLL SSQNQQPLAH GNNSFSASTF MQPPQIQVNH QQQGQINNKP  660
LVAAGRSHSG HTDGEAPSCS TSPSANNTGH DNVSPTNFLS RNQQQGQAVS VSASESVFER  720
ASNPVQELYA KTDNRINQGM VNLKSAGEQF KFKGAVTDQI DVSTAGTTYC PDVVGSAQQQ  780
QTFPLPSFGF DGDCQSHQPR NNLAFASNLE AVTSDALYSQ KDFENLVPNY GNAPRDIETE  840
LSSAAISSQS FGIPSIPFKS GCSNEVGGIN DSGIMNGGGL WPNQTQRMRT YTKVQKRGSV  900
GRSIDVTRYS GYDELRHDLA RMFGIEGQLE DPLTSDWKLV YTDHENDILL VGDDPWEEFV  960
NCVQNIKILS SAEVQQMSLD GDLAAIPATN QACSETDSGN AWKVHYEDTS AAASFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-149829996388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934670.0AB493467.1 Arabidopsis thaliana At1g19220 mRNA for hypothetical protein, partial cds, clone: RAAt1g19220.
GenBankATU536720.0U53672.2 Arabidopsis thaliana early auxin-induced IAA22 mRNA, complete cds.
GenBankAY6697940.0AY669794.1 Arabidopsis thaliana clone C105352 ARF19 (At1g19220) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306644.10.0hypothetical protein CARUB_v10008159mg
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLR0GUD50.0R0GUD5_9BRAS; Auxin response factor
STRINGAT1G19220.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19